Awe downpipe 0 These post-cat downpipes replace the factory resonated downpipes, and pair directly to existing AWE exhausts. Next Last. The Downpipes: When volume is your speed. AWE offers a 1 year on the cat! To hide the HFC'stuners came out with the 02 sensor file. S. I ran the milltek/HJS on my B6. Because it’s a cast downpipe it has a very clean sound and is honestly one of the quieter downpipes I’ve heard for this car in my opinion. The AWE exhaust Secor Ltd. 0T exhaust technology. I've got a Milltek HJS DP being installed this week and recently sold my Unitronic catback due to the drone. 00. Perfect quality, fitment, performance, tone and options to go around. 5” T304 Stainless Steel and remove an additional resonator to produce a louder and deeper tone to the exhaust note. The Touring and Track Edition Exhausts feature a modular tip design that allows drivers the choice of running double or triple 4. Presenting the AWE Exhaust Suite for the Honda FK8 Civic Type R available now at AWECivic. From record-setting GTIs to legendary intakes, intercoolers, and exhausts, AWE's been in the VW game since before there was a game. (AWE) warrants this Touring Edition exhaust system and/or Downpipe for the 2010-2016 Audi B8 / B8. After a few months of missing the exotic sound and pops /crackles on downshift I reinstalled the AWE/T. Bimmerpost ☰ Model Selection. 0TFSI Non-Resonated Downpipes. Presenting the AWE Exhaust Suite for the Audi A3 2. They bolt into the factory location and utilize the OE mounting points. AWE : Unlock Performance. A 3” T304L stainless steel downpipe-back configuration, the Touring Edition Exhaust is the perfect dose of steel for drivers looking for straight-pipe performance, a The only 3. 3 inch and 3. This can include tunes, full exhaust, turbos. 0 888-565-2257 Find a Dealer FAQs Contact My In love with AWE Downpipes. 00 Estimated to ship direct from manufacturer on 03/12/25, pending manufacturer availability. From the masters of S5 performance, AWE proudly presents the B9 S5 exhaust solution. Appreciate 1 David_domz 0. The Unitronic catback was the worst 2016 S3 P+, Tech Pack, Black Optics, Super Sport Seats, Mag-Ride, Facelift-Style Headlights, APR Stage 2 High Torque & DSG Tune, Carbon fiber Intake, Intercooler, RS3 Coils, RS7 Spark Plugs, Boost Hose System w/Bypass Hose, Catch Can, AWE Downpipe, AWE Switchpath Exhaust, 034 Motorsport Dynamic Lowering Springs, RSB End Links, Neuspeed The AWE is best all around downpipe for me, to compromise low end, great sound, and a good improvement over stock. Note: In limited cases, the factory downpipes have been known to emit minor rattling noises when paired with the AWE S4 3. Presenting the AWE Exhaust Suite for the B9 RS 5. Our 3. About 4 months ago I installed an Integrated Engineering downpipe on my 2019 MK7. 0TFSI Resonated Downpipe. The differences I noticed: 1. Lots of people running the AWE but don't be surprised if you get a bad build and no support from AWE. 0T driver. These downpipes are constructed from high-quality stainless steel and mandrel-bent for smooth, uninterrupted flow and scavenging. This is our pledge that AWE products were engineered to fit perfectly, for easy So I've finally hopped on the AWE Downpipe bandwagon and installed them this past weekend. Thanks in advanced! 2020 M340 G20 Awe track exhaust Catless downpipe Brooklyn_euro tune (not really crazy about burbles just how we ended up with tune)Comfort mode- burbles are I'm looking for feedback on the AWE touring catback when used with an aftermarket downpipe. a potent max gain of 21 hp and 24 ft-lbs of torque at the crank -- without software, when paired to an aftermarket downpipe Crafted from 3" and 2 This AWE lineup represents the finest in 3. This video would be very similar on all 3. Uses the same catalytic converter as the AWE downpipe (HJS), in the same position (just behind the turbo), but for 400 dollars less. Proudly engineered, designed, and manufactured in-house, in the USA; Featuring AWE's proprietary drone-canceling solution on Touring Edition, 180 Technology® Really? I have the AA catted downpipe mated to the AWE track right meow. Tuning B7 S4 High Flow Downpipe Update - We currently have our B7 S4 High Flow Downpipes In Stock and Ready to Ship! Not only are our downpipes thoroughly tested and documented, but our construction is second to none. 0T, Audi B8 S5 3. 2L Replaces the factory post-cat resonated downpipes with AWE Non-Resonated Downpipes Mates perfectly to AWE Touring or Track Edition Exhausts Works with the factory exhaust T304L I had my AWE Touring on for about 150 miles then installed a Cobb DP. com, EvasiveMotorsports. Thread starter GTI210; Start date Sep 19, 2018; 1; 2; 3; Next. This is our pledge that AWE products were engineered to fit perfectly, for easy Presenting the AWE Exhaust Suite for the BMW G2X M340i and M440i. 5 GTI: Max gains of 21 hp and 24 ft-lbs of torque at the crank without software (when paired to an aftermarket DP) Handcrafted from CNC mandrel-bent 3" and 2. Thanks Shop the best selection of AWE Tuning Exhaust and performance intercoolers at Summit Racing today. AWE Tuning Audi Q5 2. 0T (SKU: 3220-11010) Fitment guarantee AWE was born in 1991 as an installer of aftermarket parts. 0T (SKU: 3215-11020) Fitment guarantee AWE was born in 1991 as an installer of aftermarket parts. 5 S4 to the original retail purchaser (Consumer) against manufacturer’s defects as follows: ONE (1) YEAR on exhaust tip finish, LIFETIME on balance of parts, from purchase date from AWE directly or from an AWE authorized retailer. 5 Audi S4. I think its a really good combo for anyone out t AWE Downpipe To further hone the tone and performance of your Golf R, we’re offering both resonated and non-resonated downpipes as well. Summit Racing SpeedCard - learn how to get 15% back up to $150 Exhaust Pipes, Turbo Downpipes (11) Exhaust Tips (8) Intercoolers (8) Transmission Mounts (6) Exhaust Cutout Controllers (5) Heat Exchanger Components (4) Air Deflectors (3) Show Full boost ahead. Created with Sketch. Sounds OEM+ with stock downpipe. All AWE brand products feature the AWE Fitment Guarantee. This would be a better alternative instead of buying AWE res downpipes. All the 3" downpipes I had were louder. 2L - Polished Silver Tips $1,755. 70. The only advantage to the AWE is the fact that it comes with the no CEL guarantee, but they only warrantee the cat for a year. Feel free to send us a PM with questions, or for pricing and availability! Sophisticated sound and impressive performance for Audi's hot compact. AWE Tuning Audi SQ5 (B8) 3. 0T systems have paved the way for future exhaust technologies that can now be found in most every AWE Tuning Exhaust product. 2L owners seeking an even more aggressive sound in addition to our Track or Touring Edition Exhaust systems, we offer our Non-Resonated Downpipes. 0T Cabriolet, Audi B8 S5 3. 5 2. You pretty much can't touch the catalytic converter. The Unitronic catback was the worst I went with an AMS catted downpipe, AMS intake and the AWE Resonated touring exhaust and I love the sound of it all. £1,496. AWE does what Milltek does. Add to Cart Features a midpipe inlet adapter to allow use with stock and aftermarket (racing use only) downpipes (with outlets of 80mm) Non-Resonated and Resonated versions for perfect tone-tuning with a downpipe (AWE recommends resonated for aftermarket DP applications) Handcrafted from 3” CNC mandrel-bent, U. They work with the factory exhaust, too, if you're looking to keep it stock in the back. The intake is loud and clear to hear under power and the downpipe/exhaust combo sounds deep and mean but not obnoxiously loud. Volume at @ ~2500 rpm with slight load was too much for me. Add to Cart AWE Tuning S5 Coupe 4. Both Resonated and ACTIVE AUTOWERKE SUPRA MKV (B58) CATTED DOWNPIPE - NOW INCLUDES TURBO FLANGE GASKET In 2012, Toyota approached BMW with a proposal for a joint development effort for a new sports car that would replace the venerable and beloved Supra MK4 which was retired from production in 2002. After several years of design, development and testing, the From Mustang to Ranger to Raptor to Focus, AWE exhausts leverage decades of performance engineering to make the finest exhaust lineup for the country's OG automaker. GET THE DOWNPIPE (beware: cold starts are louder than just about anything else out there) _____ AWE offers 2 downpipe setups for these cars. F40Model Year: 2019 + Previous Generations MST intake | AWE catback | 335is clutch | CSF heat exchanger | RK Autowerks intake manifold | Orange M Perf Brake Kit | KW Street Comfort coilovers | GTS taillights V2. Presenting the Volkswagen MK7 GTI Exhaust Suite by AWE: Unlocks a potent max gain of 21 hp and 24 ft-lbs of torque at the crank -- without software, when paired to an aftermarket downpipe Crafted from 3" and 2. Replaces the factory post-cat resonated downpipes with AWE Non-Resonated Downpipes Instagram@ mywrx2016Sponsors grimmspeed, vvash auto care, mishimoto We installed Integrated Engineering Downpipes on our B8. the cat only lasted about 2 years before it threw a CEL. The Resonated Downpipes (strongly recommended for S-tronic cars) feature resonators larger than the stock units in order to produce a mellow sound volume. Sounds seriously amazing. Both versions feature our No Check Engine Light Guarantee, Fitment Guarantee, a unique flex-pipe section to isolate engine movement, and offer our Lifetime Warranty on the downpipe (one year on the catalyst). E. Created with sketchtool. £619. From the rowdy Track Edition to the sophisticated Touring Edition to resonated or non-resonated downpipes, there’s a performance option for every type of Audi S4 3. 0t Audi models, but even more so on B8 S4 and B We had so much fun ripping around in the 2017 VW MK7 and loved the exhaust offerings from AWE! We provide a full overview of AWE Tuning's exhaust options for Anything with an Executive Order (EO) has been validated to be legal to use in California. 0T (Mfg#3215-11030) fits Audi A7 3. 68. An exhaust for the hottest of VW’s hatchbacks, with options to suit every taste, and unmatched quality, fitment, performance and tone. 2 Non-Resonated Downpipe Kit For Audi S5 4. This is our pledge that AWE products were engineered to fit perfectly, for AWE Non-Resonated Exhaust System (Downpipe-Back) for 8R Q5 3. Both Resonated and My mans alex finally went stage 2 with the CTS Catted Downpipe paired up with the AWE Track Catback exhaust. The non-resonated downpipes contain no resonators and are aimed at those chasing the loudest 3. This is our pledge that AWE products were engineered to fit AWE Non-Resonated Downpipes for Audi 3. If anyone owns this already, I'd love to hear your feedback on it. You're looking at the new standard for Audi's skyrocketing small sedan. Reason: Shortly after learning about the downpipe upgrade I began to wish for a set of these. Have it and love it, very high quality. Presenting the AWE Exhaust Suite for the Honda FL5 Civic Type R: Full 3” catbacks for the FL5 Civic Type R Integrated 3” frontpipe includes a unique flange and gasket to accommodate a true 3” diameter from inlet to outlet while successfully mating to the factory interface Dyno-proven max gains of 14 h Presenting the perfected AWE Exhaust Suite for the VW MK7. Less turbo lag and you can hear the turbo spool. I bought a used Q300 and pulled the AWE/T. 0T, Audi C7 A6 Quattro 2. 46. AWE Audi A6 3. We know the pain of an AWE Downpipe. The resonated downpipes, which feature resonators larger than stock to produce a mellow tone; and non-resonated downpipes. 065” wall T304L stainless steel Direct bolt-on for Touring Edition with factory downpipe; Touring Edition @ ZTZ1010 get the downpipe and 100% go catless! Makes the AWE with stock downpipe seem quiet. Made in the USA for the USA. AWE. -sourced T304 stainless steel Dyno-developed and street-proven on the AWE in-house MK7 102mm dual tip AWE Non-Resonated Downpipes for Audi 3. AWE Non-Resonated Downpipes for Audi 8R Q5 / SQ5 3. uses the German HJS cat. Options: APR – Build quality did not seem as high as those offered by AWE. AFe B58 catted downpipe, 900 miles review 340i. I am currently running an RV6 catted downpipe and it wakes it up. Sep 19, 2018 #1 Is there a cheaper alternative to get a similar tone? I know performance wise a downpipe is a downpipe and the increase to 3" will yield results regardless of brand. The head-turning upgrade: More aggres My vote is on HKS Legamax. 37 $615. 1 Created with sketchtool. This AWE AWE Resonated Downpipes - Audi 3. The 3. 5 GTI and was initially really happy with how tame it sounded. 0T: 50-state emissions-compliant dual 3” catback exhausts Dyno-proven gains of 12 hp and 6 lb-ft of torque at the wheels Features AWE’s patented drone-canceling 180 Technology® Post-catalyst downpipes feature factory-matched flanges and robust flex sect AWE's Resonated and Non-Resonated Downpipes are sold separately. Currently running stage 2 with a catted downpipe. This is our pledge that AWE products were engineered to fit perfectly, for easy AWE Exhaust & Tuning AWE Non-Resonated Exhaust System (Downpipe-Back) for 8R Q5 3. 2L. 2010 A5 2. Im APR dual pulley. 0T Product SKU: 3215-11020. As always, AWE Tuning Non-Resonated Downpipes are only recommended for those who like it loud, and again this product cannot be returned or exchanged based upon sound satisfaction. I also know the AWE Tuning Resonated Downpipes for Audi B8 RS5. This is our pledge that AWE products were engineered to fit perfectly, for Presenting the AWE Touring and Track Edition Catback Exhausts for the VB WRX: 3” catback configurations, slip-fit inlet adapter for perfect factory downpipe fitment while leaving an open 3” connection, deep, aggressive BOXER® tone. Sounds lovely. £995. I initially was going to get the AWE touring cat-back So I am still doing research on Stage 2. There's an immediately noticeable difference in exhaust sound characteristics, though it isn't much louder than before. 0TFSI Touring Edition Exhaust + Downpipes. I want a solution that accomplishes the following: - Does not throw any dashboard lights or codes - Actually offers sound and performance gains - Mates up to stock sports exhaust - but also has the ability to mate up to AWE touring - without modification - Still passes emissions Does this . 0T, Audi B8 S4 3. AWE Tuning Non-Resonated £870. 5 inch variants are available for your 2015-2020 Audi to give it the deeper, aggressive sound you want while adding some serious power to the ground. Turn your SQ5 up to 11 with the AWE Tuning SQ5 Non-Resonated Downpipes. AWE Non-Resonated Downpipes for B8 S5 4. Let's go! AWE Downpipes. Presenting the Volkswagen MK7 GTI Exhaust Suite by AWE: Unlocks a potent max gain of 21 hp and 24 ft-lbs of torque at the crank -- without software, when paired to an aftermarket As exhaust gases exit the 3. 5” slash-cut tips via our bespoke stamped tip merges. Features resonators larger than the stock units in AWE's Resonated and Non-Resonated Downpipes are sold separately. Check Youtube/FB/Civicx forums. -sourced . 00 For both Sedan and AWE Exhaust and Downpipe Suite for Mk7 Golf R. Which is twice the size of the US catsand why its twice the price!. AWE suggested an extra Vibrant resonator if there was any additional drone with an aftermarket DP. AWE Resonated Downpipes for Audi B8 RS5 (SKU: 3215-11046) Fitment guarantee AWE was born in 1991 as an installer of aftermarket parts. On first startup I was shocked how loud it became. 0T equipped with AWE Resonated Downpipes paired to an AWE Touring Edition Exhaust, courtesy of Ryan M. These hand crafted T304 Stainless Steel Non-Resonated Downpipes produce a distinctive, more aggressive sound when coupled with the AWE Tuning ® Touring Edition Exhaust. We carry amazing, high-quality brands like AWE Tuning, Billy Boat, Unitronic, CTS Turbo and more. We know the pain of an upgrade not fitting. With such interchangeability, a dual-tip configuration can be converted into a tri-tip configuration (and No gas smell with a catted downpipe. 0T engine and flow into an AWE Tuning 180 Technology™ equipped resonator, they pass through strategically located AWE manufactures the best sounding exhausts on the planet. Turbo. I have this pretty ceramic-coated catless downpipe going on the car going on the car soon. Less noisy on idle, AWE RESONATED PERFORMANCE DOWNPIPE FOR AUDI B8 / B8. First Name Alex Joined Mar 12, 2022 Threads 0 Messages 51 Reaction score 74 The Mk6 Jetta GLI Track Edition Exhaust is best for the GLI driver looking for a more aggressive, attention-grabbing tone. 065” wall T304L stainless steel AWE Turbocharger Downpipes are designed to be paired with AWE Exhaust Systems for promoting exhilarating exhaust output and performance. 0T: Engineered, designed, and manufactured in-house at AWE 3” CNC mandrel bent system Max gains of 26 hp and 24 ft-lbs of torque at the crank Available with 90mm double walled adjustable tips, Chrom My vote is on HKS Legamax. Max gains of 16 hp and 17 ft-lbs of torque at the crank (exhaust) Downpipes and precision-engineered x-pipe included in all editions; Unlocking performance from the S5 Cabrio: Featuring AWE 180 Technology® Gains of 8 Crank HP and 9 Crank TQ Direct bolt-on Does not affect or alter any emissions devices, completely street legal Available with 90mm Diamond The newfound howl. W. Available as Touring or Track Edition, with max gains of 7 hp and 4 lb-ft of torque at the wheels. 0T Ibis white | APR KO4 | RS5 Grille | BBS CI-R 20x10 DPE CS-16 20x10 (20" RS5 Rotor for winter) | H&R OE | Caractere spoiler | AWE Quad Exhaust | AWE Downpipe | AWE Boost Gauge | 2013 Refresh Tail lights | VAG-COM Mods | Rieger RS5 Style bumper | E-Codes | STaSIS Sway Bar | KMD Tuning Diverter Valve | Eurocode Goodies | Alu If you are looking for Audi 8V S3 downpipes, you have come to the right place. Go. 1. I have personally experienced this. The optional Non-Resonated downpipes are suited for owners seeking a "loud" and aggressive sounding system. Featuring AWE 180 Technology® Max gains of 8 hp and 9 ft-lbs of torque at the c Presenting the AWE Exhaust Suite for the VW MK7 Jetta GLI: Proudly engineered, designed and manufactured in-house at AWE AWE Track Edition Exhaust - Non-Resonated - for MK7 Jetta GLI w/ Stock Downpipe - Chrome Silver Tips (SKU: 3020-22034) Fitment guarantee AWE was born in 1991 as an installer of aftermarket parts. 96. Learn more about AWE's unique offerings for the AWE Resonated Performance Downpipe for Audi B8 / B8. You'll lose a little low end refinement/smoothness and there's a nice hint of drone but I wouldn't have it any other way. It's definitely possible to pass the smog test with a downpipe, though it's still illegal. 5” T304 Stainless Steel and include a resonator to produce a mellow tone at part throttle without also hindering the sound at wide open throttle. 0T exhaust Systems represent one of the most difficult, yet most rewarding, exhaust development projects in our company history. 0T Exhaust Suite Highlights: Specially engineered for the A6 -- this is not a re-purposed A7 system Featuring AWE 180 Technology® Max power gains of 12 hp and 11 ft-lbs of torque at the crank Peak power gains of 10 hp AWE Resonated Downpipes for B8 S5 4. In addition, AWE is the only downpipe which will not cause a CEL light without special software or oxygen sensor adapters. So is a 1 year warrantee worth 400 dollars? AWE Tuning Audi S5 Cabriolet 3. Signature AWE tone, performance, and options for every taste and budget. If it's an emissions related component without an EO, it's illegal. Hand-built exhaust systems made in America, from only the best, US-sourced T304L stainless steel. GTI210 Ready to race! Location TX. 2L Replaces the factory post-cat resonated downpipes with AWE Resonated Downpipes Mates perfectly to AWE Touring or Track Edition Exhausts Works with the factory exhaust T304L stainless steel construction Emissions friendly - mates up after the cat 50 state legal No Check Engine Ligh AWE Tuning Resonated Downpipes are constructed from 2. Talking to Mike, AWE has a conversion kit to convert the Track CBE to Touring CBE, basically swapping the front section of the CBE from a straight pipe to a pipe with a resonator. 0T (SKU: 3220-11016) Fitment guarantee AWE was born in 1991 as an installer of aftermarket parts. The possibility of rattling is eliminated with the addition of an AWE downpipe. 2L -- Diamond Black Tips (SKU: 3020-33022) Fitment guarantee AWE was born in 1991 as an installer of aftermarket parts. Some reviews have suggested that the car gets loud and droney, but on the contrary I think the car is still very subdued compared to Presenting the AWE Touring Edition Exhaust for the C8 Audi A6/A7 3. I keep getting hung up on the Downpipes. Max gains of 17 hp and 23 ft-lbs of torque at the crank; If I could redo my cat-back decision, I would have gone with AWE Touring and pair it up with this downpipe to bring the sound level down a notch. And other radical things, too. The Track Edition replaces the fac No gas smell with a catted downpipe. Quote Im currently running AWE non res downpipes paired to touring system. 0T exhaust system. This is our pledge that AWE products were engineered to fit VTEC. I want to quiet down the car a little and was wondering if swapping in my stock downpipes would affect anything negatively with exhaust flow/tune and what not. 0T. Forums. Add to Cart. 0T ask an expert AWE RESONATED PERFORMANCE DOWNPIPE FOR AUDI B8 / B8. 25" U. So we guarantee ours will. AWE Resonated Performance Downpipe for Audi B8 / B8. Posted by Tomas on 24th Feb 2020 Installed on S5, where touring exhaust system was with stock downpipes (small resonators, smaller diameter pipes). 2018 SQ5 Prestige - AWE Carbon Intake, AWE Touring Resonated Exhaust, RedStar Exhaust HFC Downpipe, Turbo Systems Stage1 Hybrid Turbo, Forge Motorsports FMIC, Forge Motorsports Transmission Insert, Cete Active Suspension Controller, EPL Stage 3 (beta) tune, Carbon Fiber (w/alcantara sides) Steering Wheel, Vorstiener VFF-110 20x9 et35 Zara VTEC. 1 of 3 Go to page. com, and participating Menu. $647. Proudly designed, engineered, and manufactured in-house at AWE Max gains of 12 hp and 9 ft-lbs of torque at the wheels (turbo-back, stock software) Available as valved SwitchPath AWE Tuning Non-Resonated Downpipes are constructed from 2. The AWE exhaust amplifies what the Im almost ready to pull the trigger on an exhaust and so far I like the awe tuning track exhaust the most. What about it didn't you like? Koval Well-Known Member. Not sure of the performance gains. 0T Q5 exhaust suite worthy of the AWE name: Featuring AWE's sound cancellation solution: 180 Technology™ Engineered for optimal performance with the Eight-speed Tiptronic® transmission Featured on the quarter mile record setting AWE's in-house Q5 Available Non-Resonated Downpipe, when volume is your speed Di Note: In limited cases, the factory downpipes have been known to emit minor rattling noises when paired with the AWE S4 3. 65% more flow than stock -- ready for big power; Resonated and Non-Resonated versions for perfect downpipe-tone tuning; Features a mid-pipe inlet adapter to allow use with stock and aftermarket downpipes (with outlets of 80mm) AWE was born in 1991 as an installer of aftermarket parts. Considerations: Of the many options available, the following were given serious consideration. 5 Golf 'R' Track Edition Exhaust. AWE Tuning Resonated Downpipes for B8 S5 4. The use of de-cats, sports cats Since 1991, AWE has been synonymous with Volkswagen performance. S4 (B6 & B7 Platforms) Discussion - A. Featuring genuine German HJS metal core catalytic Catted downpipe without CEL: Bull-X downpipe. I'm looking for feedback on the AWE touring catback when used with an aftermarket downpipe. 2 Non-Resonated Downpipe Kit AWE Tuning S5 Coupé 4. This is our pledge that AWE products were engineered to fit perfectly, for easy installation by a qualified installer, every time. This is on my ‘21 3. Pros and cons are appreciated it. It's got better part throttle performance, but there wasn't a huge jump in power. 0T Coupe, Audi C7 A6 V6 3. Presenting the AWE Exhaust Suite for the Honda FK8 Civic Type R. 0L possible. C7 A6 3. 0 888-565-2257 Find a Dealer AWE was born in 1991 as an installer of aftermarket parts. AWE Tuning Mk7. 0T (SKU: 3215-11020) AWE was born in 1991 as an installer of aftermarket parts. kvckwrxmvyrpknghqgiqtnvcoqzxjyzudpqmyvmihrivqnrgnlvnvvgaghaigrlnrumwawdvrhdqzi